Research Use Access

Age verification required

This website contains research-use-only products and information. Please confirm you are at least 21 years old before entering.

Exit
🇨🇦 Ships from Canada Free express over $200 Free priority over $500 Use code BURN10 for 10% off 🇨🇦 Ships from Canada Free express over $200 Free priority over $500 Use code BURN10 for 10% off
TB-500 — clear-liquid research-compound vials
Third-party tested · ≥99%
Repair & Recovery

TB-500

Also known as: Thymosin Beta-4, Tβ4

Studied in laboratory models for its role in actin regulation, cell migration, and tissue-repair pathways.

$65.00 CAD / vial
In stock
≥99% purity 10mg CAS 77591-33-4
Quantity
Buy 3+ to unlock bulk pricing
Buy more, save more — applied automatically at checkout
QuantityDiscountPer vial
1–2$65.00
3+−5%$61.75
5+−10%$58.50
10+−15%$55.25
  • COA issued by Janoshik Analytical
  • HPLC + MS verified identity
  • Ships discreetly from Canada
  • Interac & crypto accepted

Specifications

CAS number77591-33-4
Molecular formulaC212H350N56O78S
Molecular weight4963.4 g/mol
Sequence / structureAc-LKKTETQ (active Thymosin beta-4 region; full Tβ4: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES)
Purity≥99% (HPLC)
AppearanceWhite lyophilized powder
SolubilitySoluble in bacteriostatic water / 0.9% NaCl
StorageLyophilized: -20°C, 24+ months. Reconstituted: 2-8°C, use within 4 weeks.
Available sizes10mg

Reference data compiled from public chemical databases and the peer-reviewed literature. Provided for laboratory research use only.

Research context

Studied in laboratory models for its role in actin regulation, cell migration, and tissue-repair pathways.

Thymosin Beta-4. A 43-amino-acid research compound involved in actin sequestration and tissue repair.

For research use only. Not for human or veterinary use. Sold as a laboratory reference material for in-vitro research.

Certificate of Analysis

Each lot of TB-500 is independently tested by Janoshik Analytical by HPLC (purity) and mass spectrometry (identity), and released against a batch-specific certificate of analysis. Request the COA for your lot number and we'll send the matching certificate so you can verify vial-to-lot before any assay work.

Request this batch's COA →

New to COAs? Read our guide on how to read a peptide certificate of analysis.

Frequently asked questions

What is TB-500 studied for?

Studied in laboratory models for its role in actin regulation, cell migration, and tissue-repair pathways.

What is the molecular formula of TB-500?

TB-500 has molecular formula C212H350N56O78S, and a molecular weight of ~4963.4 g/mol, and CAS number 77591-33-4.

How is TB-500 stored and reconstituted?

Soluble in bacteriostatic water / 0.9% NaCl Lyophilized: -20°C, 24+ months. Reconstituted: 2-8°C, use within 4 weeks.

Is TB-500 for human use?

No. TB-500 is supplied strictly as a laboratory reference material for research use only — not for human or veterinary use.

Researcher reviews

No researcher reviews yet for TB-500. Verified reviews from researchers appear here after a completed order.